Snag your FREE shipping for orders over R650 🎉
0187 petite ribbon heart cuff ring0187 petite ribbon heart cuff ring
  • 0187 petite ribbon heart cuff ring
  • 0187 petite ribbon heart cuff ring

0187 Petite Ribbon Heart Cuff Ring

R249.00

Looking to add a touch of charm and elegance to your style? Look no further than our Petite Ribbon Heart Cuff Ring. This delicate piece is crafted from premium 925 Sterling Silver and showcases exceptional craftsmanship and creativity. Weighing just 2g, this lightweight ring offers unparalleled comfort, allowing you to wear it all day with ease. Available in the perfect size of S/9, it's designed to fit snugly and securely on your finger. The clever folding of the thin silver ring creates a small heart in the front, adding a whimsical and enchanting design element that is sure to turn heads. Add this stunning piece to your collection and elevate your style to the next level.

Only 1 left in stock

Wishlist itWishlisted
Wishlist it
lets encryptvisamastercardpaystackpayfastyoco
Overview
Additional Info
Reviews

Petite Ribbon Heart Cuff Ring is a beautiful piece that combines elegance and whimsy to create an accessory that is not just an adornment but a representation of creativity and charm. It is crafted with precision from high-quality 925 Sterling Silver, redefining your style with its delicate design and playful heart motif.

This ring weighs only 2g, ensuring comfort throughout the day. It is available in the size of S/9, designed to fit snugly and securely on your finger, becoming a seamless part of your ensemble. The thin silver band is cleverly folded to form a small heart in the front, capturing attention and adding a touch of whimsical elegance.

The unique open cuff design of the ring makes it adjustable, allowing you to find the perfect fit that suits you. The whimsical heart design stands out against the silver backdrop, striking a balance between playfulness and sophistication.

Each Petite Ribbon Heart Cuff Ring comes elegantly packaged in a stunning silver tin, enhancing the overall experience and making it an ideal choice for gifting. The tin also serves as a protective storage solution, ensuring your precious ring remains free from dust and retains its charm over time.

Elevate your style and express your individuality with the Petite Ribbon Heart Cuff Ring, a treasure that captures the essence of both elegance and whimsy, making every moment enchanting. With its unique open cuff design and playful heart motif, this ring adds a touch of playfulness to the overall elegance of the piece. It's the perfect accessory to showcase your unique style, and it comes elegantly packaged in a beautiful silver tin for gifting or safekeeping.

Additional information

Colour

Silver

Material

925 Sterling Silver

Weight

2g

Ring Size

S / 9 - ➰ 60.00 mm

Reviews

There are no reviews yet.

Be the first to review “0187 Petite Ribbon Heart Cuff Ring”

Your email address will not be published. Required fields are marked *

Hey, have you seen these beauties?

Create & share your dream wishlist today.

Craft your personal collection of opulent desires.

Discover our exquisite sterling silver collection

Uncover jewelry that narrates tales of passion and refinement, waiting to grace your ensemble with sophistication.